CAN_340 |
| origin: |
Structure of a prokaryotic fumarate transporter reveals the architecture of the SLC26 family. |
| author: |
Geertsma, E.R., Chang, Y.N., Shaik, F.R., Neldner, Y., Pardon, E., Steyaert, J., Dutzler, R. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
GPSQVQLQESGGGLVQAGGSLRLSCAASGRTFSSDVMGWFRQAPGKEREFVAAVTRSGGKSYNADSVKGRFTISRDNAKN
TVSLQMNSLKPEDTAVYYCAAGDTAITSWYGYDYWGQGTQVTVS |
| DNA_seq: |
null |
| PubMed_ID: |
26367249 |
| PDB_ID: |
5DA0 |
| PDB_deposition_date: |
2015-08-19 |
| PDB_released_date: |
2015-09-09 |
| resolution: |
3.2Ã… |
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
 the SLC26 transporter SLC26Dg |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
Structure biology |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Nat Struct Mol Biol. 2015 Oct;22(10):803-8. doi: 10.1038/nsmb.3091. Epub 2015 Sep 14. |
|
