CAN_342 |
| origin: |
Nanobody Mediated Inhibition of Attachment of F18 Fimbriae Expressing Escherichia coli. |
| author: |
Moonens, K., De Kerpel, M., Coddens, A., Cox, E., Pardon, E., Remaut, H., De Greve, H. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGSVQAGGSLRLSCTASGYTYRKYCMGWFRQAPGKEREGVACINSGGGTSYYADSVKGRFTISQDNAKDTVF
LRMNSLKPEDTAIYYCALSSNSVCPPGHVAWYNDWGQGTQVTVSSHHHHHH |
| DNA_seq: |
null |
| PubMed_ID: |
25502211 |
| PDB_ID: |
4W6X |
| PDB_deposition_date: |
2014-08-21 |
| PDB_released_date: |
2014-12-17 |
| resolution: |
1.88Ã… |
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
 the lectin domain of F18 fimbrial adhesin FedF |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
Mediated Inhibition of Attachment of F18 Fimbriae ExpressingEscherichia coli |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
PLoS One. 2014 Dec 11;9(12):e114691. doi: 10.1371/journal.pone.0114691. eCollection 2014. |
|
