CAN_345 |
| origin: |
Crystal structure of a SLC11 (NRAMP) transporter reveals the basis for transition-metal ion transport. |
| author: |
Ehrnstorfer, I.A., Geertsma, E.R., Pardon, E., Steyaert, J., Dutzler, R. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
GPSQVQLQESGGGLVQAGGSLRLSCAASRSIFSIDTANWYRQPPGMQRELVATITRDGNANYADSVKGRFTISRDRARNT
VYLQMNSLKPEDTGVYYCNAAIRTTVRTSAQEYWGQGTQVTVSS |
| DNA_seq: |
null |
| PubMed_ID: |
25326704 |
| PDB_ID: |
4WGW |
| PDB_deposition_date: |
2014-09-19 |
| PDB_released_date: |
2014-10-22 |
| resolution: |
3.4Ã… |
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
Staphylococcus capitis divalent metal ion transporter (DMT) |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
Structure biology |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Nat Struct Mol Biol. 2014 Nov;21(11):990-6. doi: 10.1038/nsmb.2904. Epub 2014 Oct 19. |
|
