CAN_346 |
| origin: |
The Molecular Mechanism of Shiga Toxin Stx2e Neutralization by a Single-domain Antibody Targeting the Cell Receptor-binding Domain. |
| author: |
Lo, A.W., Moonens, K., De Kerpel, M., Brys, L., Pardon, E., Remaut, H., De Greve, H. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGLVQAGGSLRLSCAVSGSIFRLSTMGWYRQAPGKQREFVASITSYGDTNYRDSVKGRFTISRDNAKNTVYL
QMNSLKPEDTAVYYCNANIEAGTYYGPGRDYWGQGTQVTVSSHHHHHH |
| DNA_seq: |
null |
| PubMed_ID: |
25053417 |
| PDB_ID: |
4P2C |
| PDB_deposition_date: |
2014-02-18 |
| PDB_released_date: |
2014-07-30 |
| resolution: |
2.82Ã… |
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
Shiga Toxin Stx2e |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
prevent or treat edema disease |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
E.coli WK6 |
| publication: |
J Biol Chem. 2014 Sep 5;289(36):25374-81. doi: 10.1074/jbc.M114.566257. Epub 2014 Jul 22. |
|
