CAN_350 |
origin: |
Mechanistic analysis of allosteric and non-allosteric effects arisingPm nanobody binding to two epitopes of the dihyrofolate reductase of Escherichia coli. |
author: |
Oyen, D., Wechselberger, R., Srinivasan, V., Steyaert, J., Barlow, J.N. |
patent: |
no |
patent_application_number: |
null |
CDR1_seq: |
null |
CDR1_length: |
|
CDR2_seq: |
null |
CDR2_length: |
|
CDR3_seq: |
null |
CDR3_lentgh: |
|
protein_seq: |
QVQLQESGGGLVQAGGSLRLSCTASGRTFSSYAMGWFRQTPGKEREFVAAITWGGSTTLYADSVKGRFTMSRDNAKNTVY
LQMNSLKPEDTAVYYCAADGSQYRSTYSFRDKPDYGSWGQGTQVTVSSHHHHHH |
DNA_seq: |
null |
PubMed_ID: |
23911607 |
PDB_ID: |
4EIZ
|
PDB_deposition_date: |
2012-04-06 |
PDB_released_date: |
2013-04-24 |
resolution: |
2.2Ã… |
source_organism: |
Lama glama |
experiment_method: |
llama immunization,library construction,screen,express |
antigen: |
the dihyrofolate reductase of Escherichia coli |
antigen_chain: |
null |
antigen_seq: |
null |
function: |
Mechanistic analysis of allosteric and non-allosteric effects |
validationORprediction: |
Experiment Validation |
epitope: |
null |
bacteria_family: |
Escherichia coli |
publication: |
Biochim Biophys Acta. 2013 Oct;1834(10):2147-57. doi: 10.1016/j.bbapap.2013.07.010. Epub 2013 Jul 31. |