CAN_351 |
| origin: |
Mechanistic analysis of allosteric and non-allosteric effects arisingPm nanobody binding to two epitopes of the dihyrofolate reductase of Escherichia coli. |
| author: |
Oyen, D., Wechselberger, R., Srinivasan, V., Steyaert, J., Barlow, J.N. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGLVQAGGSLRLSCTASGRTFSSYAMGWFRQTPGKEREFVAAITWGGSTTLYADSVKGRFTMSRDNAKNTVY
LQMNSLKPEDTAVYYCAADGSQYRSTYSFRDKPDYGSWGQGTQVTVSSHHHHHH |
| DNA_seq: |
null |
| PubMed_ID: |
23911607 |
| PDB_ID: |
4EJ1 |
| PDB_deposition_date: |
2012-04-06 |
| PDB_released_date: |
2013-04-24 |
| resolution: |
1.75Ã… |
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
the dihyrofolate reductase of Escherichia coli |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
Mechanistic analysis of allosteric and non-allosteric effects |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Biochim Biophys Acta. 2013 Oct;1834(10):2147-57. doi: 10.1016/j.bbapap.2013.07.010. Epub 2013 Jul 31. |