CAN_353 |
| origin: |
Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly |
| author: |
Baranova, E.,Pnzes, R., Garcia-Pino, A., Van Gerven, N., Papapostolou, D., Pehau-Arnaudet, G., Pardo |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGLVQAGGSLRLSCAASGRTSSAYAMGWFRQAPGKEREFVAGISSKGGSTYYGASMKGRFTISRDNAKNTVY
LQMNGLAPEDTAVYYCAASDKYNFDTSHAGYGYWGQGTQVTVSSHHHHHH |
| DNA_seq: |
null |
| PubMed_ID: |
22722836 |
| PDB_ID: |
4AQ1 |
| PDB_deposition_date: |
2012-04-12 |
| PDB_released_date: |
2012-06-13 |
| resolution: |
2.42Ã… |
| source_organism: |
Lama glama |
| experiment_method: |
null |
| antigen: |
the SbsB S-layer protein of Geobacillus stearothermophilus PV72p2 |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
crystallization aid |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Nature. 2012 Jul 5;487(7405):119-22. doi: 10.1038/nature11155. |
|
