CAN_354 |
origin: |
Constraining enzyme conformational change by an antibody leads to hyperbolic inhibition. |
author: |
Oyen, D., Srinivasan, V., Steyaert, J., Barlow, J.N. |
patent: |
no |
patent_application_number: |
null |
CDR1_seq: |
null |
CDR1_length: |
|
CDR2_seq: |
null |
CDR2_length: |
|
CDR3_seq: |
null |
CDR3_lentgh: |
|
protein_seq: |
QLQESGGGLVQPGGSLRLSCAASGFTFNNYWMYWVRRAPGKGLEWVSMINPGGIITKYAESVKGRFTISRDNAKNTLYLQ
MNSLTSEDTAVYYCAKDWATGLAKKGQGTQVTVSS |
DNA_seq: |
null |
PubMed_ID: |
21238460 |
PDB_ID: |
3K74 |
PDB_deposition_date: |
2009-10-12 |
PDB_released_date: |
2010-10-20 |
resolution: |
1.95Ã… |
source_organism: |
Lama glama |
experiment_method: |
llama immunization,library construction,screen,express |
antigen: |
the enzyme dihydrofolate reductase (DHFR) |
antigen_chain: |
null |
antigen_seq: |
null |
function: |
a potent allosteric inhibitor of DHFR, giving rise to mixed hyperbolic inhibition kinetics |
validationORprediction: |
Experiment Validation |
epitope: |
null |
bacteria_family: |
Escherichia coli |
publication: |
J Mol Biol. 2011 Mar 18;407(1):138-48. doi: 10.1016/j.jmb.2011.01.017. Epub 2011 Jan 14. |