CAN_355 |
| origin: |
Crystal structure of the N-terminal domain of the secretin GspDPm ETEC determined with the assistance of a nanobody. |
| author: |
Korotkov, K.V., Pardon, E., Steyaert, J., Hol, W.G. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGLVQAGGSLRLSCAASGSIFSINSMDWDRQAPGKQRELVATITSGGSTNYADSVKGRFTISRDNAKNTVYL
QMNSLKPEDTAVYYCNANVKTWAGMTRDYWGQGTQVTVSSHHHHHH |
| DNA_seq: |
null |
| PubMed_ID: |
19217396 |
| PDB_ID: |
3EZJ |
| PDB_deposition_date: |
2008-10-22 |
| PDB_released_date: |
2009-02-17 |
| resolution: |
2.8Ã… |
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
the secretin GspDPm ETEC |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
crystallization aid |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Structure. 2009 Feb 13;17(2):255-65. doi: 10.1016/j.str.2008.11.011. |
|
