CAN_356 |
| origin: |
Nanobody-aided structure determination of the EpsI:EpsJ pseudopilin heterodimerPm Vibrio vulnificus |
| author: |
Lam, A.Y., Pardon, E., Korotkov, K.V., Hol, W.G., Steyaert, J. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGLVQPGGSLRLSCAASGFAFSGYAMSWVRQAPGKGLEWVSGINRDGSTSYTAPVKGRFTISRDNAKNILYL
QMNSLRPEDTAVYYCAKWLGGRDWYDRGQGTQVTVS |
| DNA_seq: |
null |
| PubMed_ID: |
19118632 |
| PDB_ID: |
3CFI |
| PDB_deposition_date: |
2008-03-03 |
| PDB_released_date: |
2009-01-13 |
| resolution: |
2.58Ã… |
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
the EpsI:EpsJ pseudopilin heterodimerPm Vibrio vulnificus. |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
crystallization aid |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
J Struct Biol. 2009 Apr;166(1):8-15. doi: 10.1016/j.jsb.2008.11.008. Epub 2008 Dec 10. |
|
