CAN_357 |
| origin: |
Selective Inhibitors of Cyclin G Associated Kinase (GAK) as Anti-Hepatitis C Agents. |
| author: |
Kovackova, S., Chang, L., Bekerman, E., Neveu, G., Barouch-Bentov, R., Chaikuad, A., Heroven, C., Sa |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGSVQAGGSLRLSCGASEYTSRMGWFRQAPGAEREGVACIHRQSNLSYYSDSVRGRFTISQDNAKTTAFLLM
SSLKPEDTAIYYCATTTDCAAFVERATAITAGQGTQVTVSSAAAYPYDVPDYGSHHHHHH |
| DNA_seq: |
null |
| PubMed_ID: |
25822739 |
| PDB_ID: |
4Y8D |
| PDB_deposition_date: |
2015-02-16 |
| PDB_released_date: |
2015-04-08 |
| resolution: |
2.1Ã… |
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
Cyclin G Associated Kinase (GAK) |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
null |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
J Med Chem. 2015 Apr 23;58(8):3393-410. doi: 10.1021/jm501759m. Epub 2015 Apr 9. |
|