CAN_358 |
| origin: |
Structural biology. Structural basis for chemokine recognition and activation of a viral G protein-coupled receptor. |
| author: |
Burg, J.S., Ingram, J.R., Venkatakrishnan, A.J., Jude, K.M., Dukkipati, A., Feinberg, E.N., Angelini |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
GPGSQVQLVESGGGLVRPGGSLRLSCAASGSIFTIYAMGWYRQAPGKQRELVARITFGGDTNYADSVKGRFTISRDNAKN
AVYLQMNSLKPEDTAVYYCNAEETIVEEADYWGQGTQVTVSSRAAAHHHHHHHH |
| DNA_seq: |
null |
| PubMed_ID: |
25745166 |
| PDB_ID: |
4XT1 |
| PDB_deposition_date: |
2015-01-22 |
| PDB_released_date: |
2015-03-04 |
| resolution: |
2.89Ã… |
| source_organism: |
Vicugna pacos |
| experiment_method: |
null |
| antigen: |
G protein-coupled receptors (GPCRs) |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
Structure biology |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Science. 2015 Mar 6;347(6226):1113-7. doi: 10.1126/science.aaa5026. |
|
