CAN_359 |
| origin: |
A nanobody modulates the p53 transcriptional program without perturbing its functional architecture. |
| author: |
Bethuyne, J., De Gieter, S., Zwaenepoel, O., Garcia-Pino, A., Durinck, K., Verhelle, A., Hassanzadeh |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
AQVQLQESGGGLVQAGGSLRLSCAASERTFSTYAMGWFRQAPGREREFLAQINWSGTTTYYAESVKDRTTISRDNAKNTV
YLEMNNLNADDTGIYFCAAHPQRGWGSTLGWTYWGQGTQVTVSSGGGGSGGGKPIPNPLLGLDSTRTGHHHHHH |
| DNA_seq: |
null |
| PubMed_ID: |
25324313 |
| PDB_ID: |
4QO1 |
| PDB_deposition_date: |
2014-06-19 |
| PDB_released_date: |
2014-10-29 |
| resolution: |
1.92Ã… |
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
p53 DNA binding domain |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
modulates the p53 transcriptional program without perturbing its functional architecture |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Nucleic Acids Res. 2014 Nov 10;42(20):12928-38. doi: 10.1093/nar/gku962. Epub 2014 Oct 16. |
|
