CAN_362 |
origin: |
Activation and allosteric modulation of a muscarinic acetylcholine receptor. |
author: |
Kruse, A.C., Ring, A.M., Manglik, A., Hu, J., Hu, K., Eitel, K., Hubner, H., Pardon, E., Valant, C., |
patent: |
no |
patent_application_number: |
null |
CDR1_seq: |
null |
CDR1_length: |
|
CDR2_seq: |
null |
CDR2_length: |
|
CDR3_seq: |
null |
CDR3_lentgh: |
|
protein_seq: |
GPGSQVQLQESGGGLVQAGDSLRLSCAASGFDFDNFDDYAIGWFRQAPGQEREGVSCIDPSDGSTIYADSAKGRFTISSD
NAENTVYLQMNSLKPEDTAVYVCSAWTLFHSDEYWGQGTQVTVSS |
DNA_seq: |
null |
PubMed_ID: |
24256733 |
PDB_ID: |
4MQS |
PDB_deposition_date: |
2013-09-16 |
PDB_released_date: |
2013-11-27 |
resolution: |
3.5Ã… |
source_organism: |
Lama glama |
experiment_method: |
llama immunization,library construction,screen,express |
antigen: |
Muscarinic acetylcholine receptor2 |
antigen_chain: |
null |
antigen_seq: |
null |
function: |
crystallization aid |
validationORprediction: |
Experiment Validation |
epitope: |
null |
bacteria_family: |
Escherichia coli |
publication: |
Nature. 2013 Dec 5;504(7478):101-6. doi: 10.1038/nature12735. Epub 2013 Nov 20. |
|