CAN_363 |
| origin: |
Activation and allosteric modulation of a muscarinic acetylcholine receptor. |
| author: |
Kruse, A.C., Ring, A.M., Manglik, A., Hu, J., Hu, K., Eitel, K., Hubner, H., Pardon, E., Valant, C., |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
GPGSQVQLQESGGGLVQAGDSLRLSCAASGFDFDNFDDYAIGWFRQAPGQEREGVSCIDPSDGSTIYADSAKGRFTISSD
NAENTVYLQMNSLKPEDTAVYVCSAWTLFHSDEYWGQGTQVTVSS |
| DNA_seq: |
null |
| PubMed_ID: |
24256733 |
| PDB_ID: |
4MQT |
| PDB_deposition_date: |
2013-09-16 |
| PDB_released_date: |
2013-11-27 |
| resolution: |
3.7Ã… |
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
Muscarinic acetylcholine receptor3 |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
crystallization aid |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Nature. 2013 Dec 5;504(7478):101-6. doi: 10.1038/nature12735. Epub 2013 Nov 20. |
|
