CAN_365 |
| origin: |
Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies. |
| author: |
Burger, D., Stihle, M., Sharma, A., Di Lello, P., Benz, J., D'Arcy, B., Debulpaep, M., Fry, D., Hube |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGLVQAGGSLRLSCTASVNIIGGNHWAWYRQAPGQQRDLVASLSRYNANYADSVKGRFTISRDNAKNAAYLQMNSLKPEDTAIYFCALENYYWGQGTQVTVSSHHHHHHEPEA
|
| DNA_seq: |
null |
| PubMed_ID: |
27226599 |
| PDB_ID: |
5IP4 |
| PDB_deposition_date: |
2016-03-09 |
| PDB_released_date: |
2016-05-18 |
| resolution: |
1.81Ã…
|
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
the Human Doublecortin |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
obtain structures of two doublecortin domains |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
J Biol Chem. 2016 Jul 29;291(31):16292-306. doi: 10.1074/jbc.M116.726547. Epub 2016 May 10. |
|
