CAN_366 |
origin: |
Crystal structure of the proteasomal deubiquitylation module Rpn8-Rpn11 |
author: |
Pathare, G.R., Nagy, I., Sledz, P., Anderson, D.J., Zhou, H.J., Pardon, E., Steyaert, J., Forster, F |
patent: |
no |
patent_application_number: |
null |
CDR1_seq: |
null |
CDR1_length: |
|
CDR2_seq: |
null |
CDR2_length: |
|
CDR3_seq: |
null |
CDR3_lentgh: |
|
protein_seq: |
MQVQLQESGGGLVPAGGSLRLSCVDSGRTFSSTVMAWFRQAPGKEREFVATIRWSGGNTYYADSVKGRFTISRDNARNTV
YLQMNSLKPEDTAVYYCAGGTYYGTLSYKYDFWGRGTQVTVSSHHHHHHEPEA |
DNA_seq: |
null |
PubMed_ID: |
24516147 |
PDB_ID: |
4OCL |
PDB_deposition_date: |
2014-01-09 |
PDB_released_date: |
2014-01-29 |
resolution: |
2.4Ã…
|
source_organism: |
Lama glama |
experiment_method: |
llama immunization,library construction,screen,express |
antigen: |
 the proteasomal deubiquitylation module Rpn8-Rpn11 |
antigen_chain: |
null |
antigen_seq: |
null |
function: |
crystallization aid |
validationORprediction: |
Experimentally Validated |
epitope: |
null |
bacteria_family: |
Escherichia coli |
publication: |
Proc Natl Acad Sci U S A. 2014 Feb 25;111(8):2984-9. doi: 10.1073/pnas.1400546111. Epub 2014 Feb 10. |
|