CAN_368 |
| origin: |
Crystal structure of the proteasomal deubiquitylation module Rpn8-Rpn11 |
| author: |
Pathare, G.R., Nagy, I., Sledz, P., Anderson, D.J., Zhou, H.J., Pardon, E., Steyaert, J., Forster, F |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
MQVQLQESGGGLVPAGGSLRLSCVDSGRTFSSTVMAWFRQAPGKEREFVATIRWSGGNTYYADSVKGRFTISRDNARNTV
YLQMNSLKPEDTAVYYCAGGTYYGTLSYKYDFWGRGTQVTVSSHHHHHHEPEA
|
| DNA_seq: |
null |
| PubMed_ID: |
24516147 |
| PDB_ID: |
4OCN |
| PDB_deposition_date: |
2014-01-09 |
| PDB_released_date: |
2014-01-29 |
| resolution: |
2.25Ã…
|
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
 the proteasomal deubiquitylation module Rpn8-Rpn13 |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
crystallization aid |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Proc Natl Acad Sci U S A. 2014 Feb 25;111(8):2984-9. doi: 10.1073/pnas.1400546111. Epub 2014 Feb 10. |
|