CAN_372 |
| origin: |
Crystal Structure of the Bloom'S Syndrome Helicase Indicates a Role for the Hrdc Domain in Conformational Changes |
| author: |
Newman, J.A., Savitsky, P., Allerston, C.K., Bizard, A.H., Ozer, O., Sarlos, K., Liu, Y., Pardon, E. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
MKYLLPTAAAGLLLLAAQPAMAQVQLQESGGGLVQAGGSLRLSCAASGIWFSINNMAWYRQTPGKQRERIAIITSAGTTN
YVDSVKGRFTISRDDAKNTMYLQMNSLIPEDTAVYYCNLVADYDMGFQSFWGRGTQVTVSSHHHHHH
|
| DNA_seq: |
null |
| PubMed_ID: |
25901030 |
| PDB_ID: |
4CDG |
| PDB_deposition_date: |
2013-10-31 |
| PDB_released_date: |
2013-11-13 |
| resolution: |
2.79Ã…
|
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
the Bloom's syndrome helicase BLM |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
Structure biology |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Nucleic Acids Res. 2015 May 26;43(10):5221-35. doi: 10.1093/nar/gkv373. Epub 2015 Apr 21. |
|
