CAN_373 |
origin: |
Structure of Cyclin G-Associated Kinase (Gak) Trapped in Different Conformations Using Nanobodies |
author: |
Chaikuad, A., Keates, T., Vincke, C., Kaufholz, M., Zenn, M., Zimmermann, B., Gutierrez, C., Zhang, |
patent: |
no |
patent_application_number: |
null |
CDR1_seq: |
null |
CDR1_length: |
|
CDR2_seq: |
null |
CDR2_length: |
|
CDR3_seq: |
null |
CDR3_lentgh: |
|
protein_seq: |
QVQLQESGGGLVQPGGSLRLSCSASGFKFNDSYMSWVRRVPGKGLEWVAGIWEDSSAAHYRDSVKGRFTISRDNAKNMLY
LQMSSLKSDDTGLYYCVRRGYSGDYRPINNPSSQGTQVTVSSAAAYPYDVPDYGSHHHHHH
|
DNA_seq: |
null |
PubMed_ID: |
24438162 |
PDB_ID: |
4C57 |
PDB_deposition_date: |
2013-09-10 |
PDB_released_date: |
2013-10-09 |
resolution: |
2.55Ã…
|
source_organism: |
Lama glama |
experiment_method: |
llama immunization,library construction,screen,express |
antigen: |
GAK kinase |
antigen_chain: |
null |
antigen_seq: |
null |
function: |
gain insight into conformational changes of dynamic molecules |
validationORprediction: |
Experimentally Validated |
epitope: |
null |
bacteria_family: |
Escherichia coli |
publication: |
Biochem J. 2014 Apr 1;459(1):59-69. doi: 10.1042/BJ20131399. |
|