CAN_375 |
| origin: |
Structure of Cyclin G-Associated Kinase (Gak) Trapped in Different Conformations Using Nanobodies |
| author: |
Chaikuad, A., Keates, T., Vincke, C., Kaufholz, M., Zenn, M., Zimmermann, B., Gutierrez, C., Zhang, |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGSVQAGGSLRLSCGASEYTSRMGWFRQAPGAEREGVACIHRQSNLSYYSDSVRGRFTISQDNAKTTAFLLM
SSLKPEDTAIYYCATTTDCAAFVERATAITAGQGTQVTVSSAAAYPYDVPDYGSHHHHHH
|
| DNA_seq: |
null |
| PubMed_ID: |
24438162 |
| PDB_ID: |
4C59 |
| PDB_deposition_date: |
2013-09-10 |
| PDB_released_date: |
2013-10-09 |
| resolution: |
2.8Ã…
|
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
GAK kinase |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
gain insight into conformational changes of dynamic molecules |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Biochem J. 2014 Apr 1;459(1):59-69. doi: 10.1042/BJ20131399. |
|
