CAN_377 |
| origin: |
Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains |
| author: |
Schmitz, K.R., Bagchi, A., Roovers, R.C., van Bergen En Henegouwen, P.M.P., Ferguson, K.M. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVKLEESGGGSVQTGGSLRLTCAASGRTSRSYGMGWFRQAPGKEREFVSGISWRGDSTGYADSVKGRFTISRDNAKNTVD
LQMNSLKPEDTAIYYCAAAAGSAWYGTLYEYDYWGQGTQVTVSSALEHHHHHH
|
| DNA_seq: |
null |
| PubMed_ID: |
23791944 |
| PDB_ID: |
4KRM |
| PDB_deposition_date: |
2013-05-16 |
| PDB_released_date: |
2013-08-28 |
| resolution: |
2.65Ã…
|
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
The epidermal growth factor receptor (EGFR)Â |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
tumor imaging and/or cancer therapy |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
Spodoptera frugiperda, Escherichia coli |
| publication: |
Structure. 2013 Jul 2;21(7):1214-24. doi: 10.1016/j.str.2013.05.008. Epub 2013 Jun 20. |
