CAN_380 |
origin: |
Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains |
author: |
Schmitz, K.R., Bagchi, A., Roovers, R.C., van Bergen En Henegouwen, P.M.P., Ferguson, K.M. |
patent: |
no |
patent_application_number: |
null |
CDR1_seq: |
null |
CDR1_length: |
|
CDR2_seq: |
null |
CDR2_length: |
|
CDR3_seq: |
null |
CDR3_lentgh: |
|
protein_seq: |
EVQLVESGGGLVQAGGSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVVAINWSSGSTYYADSVKGRFTISRDNAKNTMY
LQMNSLKPEDTAVYYCAAGYQINSGNYNFKDYEYDYWGQGTQVTVSSALEHHHHHH
|
DNA_seq: |
null |
PubMed_ID: |
23791944 |
PDB_ID: |
4KRP |
PDB_deposition_date: |
2013-05-16 |
PDB_released_date: |
2013-08-28 |
resolution: |
2.82Ã…
|
source_organism: |
Lama glama |
experiment_method: |
llama immunization,library construction,screen,express |
antigen: |
The epidermal growth factor receptor (EGFR)Â |
antigen_chain: |
null |
antigen_seq: |
null |
function: |
tumor imaging and/or cancer therapy |
validationORprediction: |
Experimentally Validated |
epitope: |
null |
bacteria_family: |
Mus musculus, Mus musculus, Escherichia coli, Spodoptera frugiperda |
publication: |
Structure. 2013 Jul 2;21(7):1214-24. doi: 10.1016/j.str.2013.05.008. Epub 2013 Jun 20. |