CAN_381 |
| origin: |
The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody |
| author: |
Khamrui, S., Turley, S., Pardon, E., Steyaert, J., Fan, E., Verlinde, C.L., Bergman, L.W., Hol, W.G. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
EVQLQESGGGTVQPGGSLKLSCSAAPERAFSNYAMGWFRQAPGQEREFVAGITGSGRSQYYADSVKGRFTISRDNAMNAV
YLQMNSVKAEDTAVYYCAARVVPVFSDSTKGYVYWGQGTQVTVSSHHHHHHEPEA
|
| DNA_seq: |
null |
| PubMed_ID: |
23831371 |
| PDB_ID: |
4GFT |
| PDB_deposition_date: |
2012-08-03 |
| PDB_released_date: |
2013-07-03 |
| resolution: |
1.6Ã…
|
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
Malaria invasion machinery protein |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
crystallization aid |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Mol Biochem Parasitol. 2013 Aug;190(2):87-91. doi: 10.1016/j.molbiopara.2013.06.003. Epub 2013 Jul 4. |
|
