CAN_382 |
origin: |
Mapping the Conformational Space Accessible to Bace2 Using Surface Mutants and Co-Crystals with Fab-Fragments, Fynomers, and Xaperones |
author: |
Banner, D.W., Gsell, B., Benz, J., Bertschinger, J., Burger, D., Brack, S., Cuppuleri, S., Debulpaep |
patent: |
no |
patent_application_number: |
null |
CDR1_seq: |
null |
CDR1_length: |
|
CDR2_seq: |
null |
CDR2_length: |
|
CDR3_seq: |
null |
CDR3_lentgh: |
|
protein_seq: |
QVQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLY
LQMNSLKPEDTAVYYCTSAGRRGPGTQVTVSSHHHHHHEPEA
|
DNA_seq: |
null |
PubMed_ID: |
23695257 |
PDB_ID: |
3ZKQ |
PDB_deposition_date: |
2013-01-24 |
PDB_released_date: |
2013-05-29 |
resolution: |
1.51Ã…
|
source_organism: |
Lama glama |
experiment_method: |
llama immunization,library construction,screen,express |
antigen: |
The aspartic protease BACE2 |
antigen_chain: |
null |
antigen_seq: |
null |
function: |
crystallization aid |
validationORprediction: |
Experimentally Validated |
epitope: |
null |
bacteria_family: |
Escherichia coli |
publication: |
Acta Crystallogr D Biol Crystallogr. 2013 Jun;69(Pt 6):1124-37. doi: 10.1107/S0907444913006574. Epub 2013 May 15. |
|