CAN_385 |
| origin: |
Mapping the Conformational Space Accessible to Bace2 Using Surface Mutants and Co-Crystals with Fab-Fragments, Fynomers, and Xaperones |
| author: |
Banner, D.W., Gsell, B., Benz, J., Bertschinger, J., Burger, D., Brack, S., Cuppuleri, S., Debulpaep |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLY
LQMNSLKPEDTAVYYCTSAGRRGPGTQVTVSSHHHHHHEPEA
|
| DNA_seq: |
null |
| PubMed_ID: |
23695257 |
| PDB_ID: |
4BFB |
| PDB_deposition_date: |
2013-03-18 |
| PDB_released_date: |
2013-05-29 |
| resolution: |
2.21Ã…
|
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
NA |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
null |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Acta Crystallogr D Biol Crystallogr. 2013 Jun;69(Pt 6):1124-37. doi: 10.1107/S0907444913006574. Epub 2013 May 15. |
|