CAN_390 |
| origin: |
Nanobody binding to a conserved epitope promotes norovirus particle disassembly |
| author: |
Koromyslova, A.D., Hansman, G.S. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
DVQLVESGGGLVQPGGSLRLSCAASGSIFSIYAMGWYRQAPGKQRELVASISSGGGTNYADSVKGRFTISGDNAKNTVYL
QMNSLKPEDTAVYYCKREDYSAYAPPSGSRGRGTQVTVSSHHHHHH
|
| DNA_seq: |
null |
| PubMed_ID: |
27409812 |
| PDB_ID: |
4X7D |
| PDB_deposition_date: |
2014-12-09 |
| PDB_released_date: |
2014-12-31 |
| resolution: |
2.15Ã…
|
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,screen,express |
| antigen: |
2012 NSW GII.4 P domain of Human noroviruses |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
work as a diagnostic reagent in norovirus detection systems but also could function as a broadly reactive GII norovirus antiviral |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
J Virol. 2015 Mar;89(5):2718-30. doi: 10.1128/JVI.03176-14. Epub 2014 Dec 17. |
