CAN_394 |
| origin: |
Viral infection modulation and neutralization by camelid nanobodies |
| author: |
Desmyter, A., Farenc, C., Mahony, J., Spinelli, S., Bebeacua, C., Blangy, S., Veesler, D., van Sinde |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
DVQLVESGGGLVQPGGSLRLSCEASGFSFDDYAIGWFRQAPGKEREGVSYISMSDGRTYVADSVTGRFTISSDNAKNTVY
LQMNSLKLEDTAVYYCAAGRFVTFGSAWSFVGGGPYGIDYWGKGTLVTVSS
|
| DNA_seq: |
null |
| PubMed_ID: |
24056936 |
| PDB_ID: |
4HEP |
| PDB_deposition_date: |
2012-10-04 |
| PDB_released_date: |
2013-03-20 |
| resolution: |
1.75Ã…
|
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,pan,express |
| antigen: |
lactococcal phage TP901-1 |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
circumventing lactococcal phages viral infection on dairy fermentation |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
subcloned into the pHEN6 expression vector (28),transform to Escherichia coli, |
| publication: |
Proc Natl Acad Sci U S A. 2013 Apr 9;110(15):E1371-9. doi: 10.1073/pnas.1301336110. Epub 2013 Mar 25. |
|
