CAN_396 |
| origin: |
Crystal structure of the beta2 adrenergic receptor-Gs protein complex |
| author: |
Rasmussen, S.G., DeVree, B.T., Zou, Y., Kruse, A.C., Chung, K.Y., Kobilka, T.S., Thian, F.S., Chae, |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGLVQPGGSLRLSCAASGFTFSNYKMNWVRQAPGKGLEWVSDISQSGASISYTGSVKGRFTISRDNAKNTLY
LQMNSLKPEDTAVYYCARCPAPFTRDCFDVTSTTYAYRGQGTQVTVSSHHHHHHEPEA
|
| DNA_seq: |
null |
| PubMed_ID: |
23530214 |
| PDB_ID: |
3SN6 |
| PDB_deposition_date: |
2011-06-28 |
| PDB_released_date: |
2011-07-20 |
| resolution: |
3.2Ã…
|
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,pan,express |
| antigen: |
the beta2 adrenergic receptor-Gs protein complex |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
crystallization aid |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Nature. 2011 Jul 19;477(7366):549-55. doi: 10.1038/nature10361. |
|
