CAN_397 |
| origin: |
Structure of a nanobody-stabilized active state of the β2 adrenoceptor |
| author: |
Rasmussen, S.G., Choi, H.J., Fung, J.J., Pardon, E., Casarosa, P., Chae, P.S., DeVree, B.T., Rosenba |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGLVQAGGSLRLSCAASGSIFSINTMGWYRQAPGKQRELVAAIHSGGSTNYANSVKGRFTISRDNAANTVYL
QMNSLKPEDTAVYYCNVKDYGAVLYEYDYWGQGTQVTVSSHHHHHH
|
| DNA_seq: |
null |
| PubMed_ID: |
21772288 |
| PDB_ID: |
3P0G |
| PDB_deposition_date: |
2010-09-28 |
| PDB_released_date: |
2011-01-19 |
| resolution: |
3.5Ã…
|
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,pan,express |
| antigen: |
 the beta2 adrenoceptor |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
crystallization aid |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
expressed in the periplasm of E. coli strain WK6 |
| publication: |
Nature. 2011 Jan 13;469(7329):175-80. doi: 10.1038/nature09648. |
|
