CAN_398 |
| origin: |
The unexpected structure of the designed protein Octarellin V.1 forms a challenge for protein structure prediction tools |
| author: |
Figueroa, M., Sleutel, M., Vandevenne, M., Parvizi, G., Attout, S., Jacquin, O., Vandenameele, J., F |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGLVQAGGSLRLSCAASGGTFSTYGMGWFRQAPGKEREFVAASSWTGANTYYADSVRGRFTISRDNAKNTVY
LEMNSLKPEDTAVYYCAARRWLGGSYFDPGNYDFWGQGTQVTVSSHHHHHHEPEA
|
| DNA_seq: |
null |
| PubMed_ID: |
21228869 |
| PDB_ID: |
5BOP |
| PDB_deposition_date: |
2015-05-27 |
| PDB_released_date: |
2016-05-25 |
| resolution: |
1.95Ã…
|
| source_organism: |
Lama glama |
| experiment_method: |
llama immunization,library construction,pan,express |
| antigen: |
the artificial protein Octarellin V |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
protein design |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
J Struct Biol. 2016 Jul;195(1):19-30. doi: 10.1016/j.jsb.2016.05.004. Epub 2016 May 12. |
|
