CAN_399 |
| origin: |
A nanobody binding to non-amyloidogenic regions of the protein human lysozyme enhances partial unfolding but inhibits amyloid fibril formation. |
| author: |
De Genst, E., Chan, P.H., Pardon, E., Hsu, S.T., Kumita, J.R., Christodoulou, J., Menzer, L., Chirga |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGSVQAGGSLRLSCEASGLSTTVMAWFRQAPGKEREGVAAIYTGDGFPYYADSVKGRFTISQDNAKNRMYLQ
MNSLEPEDTAMYYCAAKTGAFSYGSLWWMSRAYNHWGQGTQVTVSSHHHHHH
|
| DNA_seq: |
null |
| PubMed_ID: |
23791944 |
| PDB_ID: |
4I0C |
| PDB_deposition_date: |
2012-11-16 |
| PDB_released_date: |
2013-10-09 |
| resolution: |
1.95Ã… |
| source_organism: |
Camelus dromedarius |
| experiment_method: |
dromedary immunization,library construction,pan,express |
| antigen: |
wild-type human lysozyme(WT-HuL) |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
therapeutics to combat protein misfolding diseases |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
J Phys Chem B. 2013 Oct 24;117(42):13245-58. doi: 10.1021/jp403425z. Epub 2013 Sep 24. |
|
