CAN_400 |
| origin: |
Atomic Structure of a Nanobody-Trapped Domain-Swapped Dimer of an Amyloidogenic {Beta}2-Microglobulin Variant. |
| author: |
Domanska, K., Vanderhaegen, S., Srinivasan, V., Pardon, E., Dupeux, F., Marquez, J.A., Giorgetti, S. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGSVQAGGSLRLSCAASGYTDSRYCMAWFRQAPGKEREWVARINSGRDITYYADSVKGRFTFSQDNAKNTVY
LQMDSLEPEDTATYYCATDIPLRCRDIVAKGGDGFRYWGQGTQVTVSS
|
| DNA_seq: |
null |
| PubMed_ID: |
21220305 |
| PDB_ID: |
2X89 |
| PDB_deposition_date: |
2010-03-07 |
| PDB_released_date: |
2011-01-19 |
| resolution: |
2.16Ã… |
| source_organism: |
Camelus dromedarius |
| experiment_method: |
One camel (Camelus dromedarius) and one llama (Llama glama) immunization,library construction,pan,express |
| antigen: |
Beta2_microglobulin |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
Structure biology |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
Proc Natl Acad Sci U S A. 2011 Jan 25;108(4):1314-9. doi: 10.1073/pnas.1008560108. Epub 2011 Jan 10. |
|
