CAN_401 |
| origin: |
General Strategy to Humanize a Camelid Single-domain Antibody and Identification of a Universal Humanized Nanobody Scaffold |
| author: |
Vincke, C., Loris, R., Saerens, D., Martinez-Rodriguez, S., Muyldermans, S., Conrath, K. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLVESGGGSVQAGGSLRLSCSASGYTYISGWFRQAPGKGLEWVAAIRSSDGTTYYADSVKGRFTISQDNAKNTVYLQM
NSLKPEDTAMYYCAATEVAGWPLDIGIYDYWGQGTQVTVSSHHHHHH
|
| DNA_seq: |
null |
| PubMed_ID: |
 19010777 |
| PDB_ID: |
3EBA |
| PDB_deposition_date: |
2008-08-27 |
| PDB_released_date: |
2008-12-02 |
| resolution: |
1.85Ã… |
| source_organism: |
Camelus dromedarius |
| experiment_method: |
null |
| antigen: |
human lysozyme (HuL) |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
General Strategy to Humanize a Camelid Single-domain Antibody |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
Escherichia coli |
| publication: |
J Biol Chem. 2009 Jan 30;284(5):3273-84. doi: 10.1074/jbc.M806889200. Epub 2008 Nov 14. |
|
