CAN_405 |
| origin: |
Five of Five VHHs Neutralizing Poliovirus Bind the Receptor-Binding Site. |
| author: |
Strauss, M., Schotte, L., Thys, B., Filman, D.J., Hogle, J.M. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QVQLQESGGGSVQAGGSLTLSCAASGITYCMGWYRQVRGKEREGVAFIKTNDGTTDYADSVKGRFTISQNHATKTVYLQM
NSLKPEDTAAYYCAATWRWSCPLDPEGYQYWGQGTQVTVSSHHHHHH |
| DNA_seq: |
null |
| PubMed_ID: |
26764003 |
| PDB_ID: |
3JBF |
| PDB_deposition_date: |
2015-08-02 |
| PDB_released_date: |
2016-01-27 |
| resolution: |
4.8Ã… |
| source_organism: |
Camelus dromedarius |
| experiment_method: |
null |
| antigen: |
poliovirus type 1 |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
antiviral agents or reagents for standardization of vaccine quality control |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
null |
| publication: |
J Virol. 2016 Jan 13;90(7):3496-505. doi: 10.1128/JVI.03017-15. |
|
