CAN_409 |
| origin: |
Crystal structure of the metazoan Nup62Nup58Nup54 nucleoporin complex. |
| author: |
Chug, H., Trakhanov, S., Hulsmann, B.B., Pleiner, T., Gorlich, D. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
AGTGSGQVQLQESGGGLVQPGGSLRLSCVVSGDYYAIGWFRQAPGKEREGVAAISSRDGSTYYPDAVKGRFTISRDNAKN
TVYLQMNSLKPEDTAVYYCAADRRQRWGPYYYLSALEYVYWGQGTQVTVSS |
| DNA_seq: |
null |
| PubMed_ID: |
26292704 |
| PDB_ID: |
5C2U |
| PDB_deposition_date: |
2015-06-16 |
| PDB_released_date: |
2015-08-26 |
| resolution: |
1.55Ã… |
| source_organism: |
Camelus dromedarius |
| experiment_method: |
null |
| antigen: |
Ferredoxin-like domain of nucleoporin Nup54 |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
crystallization aid |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
null |
| publication: |
Science. 2015 Oct 2;350(6256):106-10. doi: 10.1126/science.aac7420. Epub 2015 Aug 20. |
|
