CAN_412 |
| origin: |
Structural and thermodynamic analysis of the GFP:GFP-nanobody complex. |
| author: |
Kubala, M.H., Kovtun, O., Alexandrov, K., Collins, B.M. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
MQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTV
YLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVSSKHHHHHH |
| DNA_seq: |
null |
| PubMed_ID: |
20945358 |
| PDB_ID: |
3OGO |
| PDB_deposition_date: |
2010-08-17 |
| PDB_released_date: |
2010-08-25 |
| resolution: |
 2.8Å |
| source_organism: |
Camelus dromedarius |
| experiment_method: |
null |
| antigen: |
GFP |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
fluorescent probes |
| validationORprediction: |
Experiment Validation |
| epitope: |
null |
| bacteria_family: |
null |
| publication: |
Protein Sci. 2010 Dec;19(12):2389-401. doi: 10.1002/pro.519. |
|
