CAN_430 |
origin: |
Nanobody Mediated Inhibition of Attachment of F18 Fimbriae Expressing Escherichia coli. |
author: |
Moonens, K., De Kerpel, M., Coddens, A., Cox, E., Pardon, E., Remaut, H., De Greve, H. |
patent: |
no |
patent_application_number: |
null |
CDR1_seq: |
null |
CDR1_length: |
|
CDR2_seq: |
null |
CDR2_length: |
|
CDR3_seq: |
null |
CDR3_lentgh: |
|
protein_seq: |
QVQLQESGGGSVQAGGSLRLSCTASGYTYRKYCMGWFRQAPGKEREGVACINSGGGTSYYADSVKGRFTISQDNAKDTVF
LRMNSLKPEDTAIYYCALSSNSVCPPGHVAWYNDWGQGTQVTVSSHHHHHH |
DNA_seq: |
null |
PubMed_ID: |
25502211 |
PDB_ID: |
4W6X |
PDB_deposition_date: |
2014-08-21 |
PDB_released_date: |
2014-12-17 |
resolution: |
1.88Ã… |
source_organism: |
Lama glama |
experiment_method: |
null |
antigen: |
he lectin domain of the F19 fimbrial adhesin FedF |
antigen_chain: |
null |
antigen_seq: |
null |
function: |
Post-weaning diarrhea and edema disease |
validationORprediction: |
Experimentally Validated |
epitope: |
null |
bacteria_family: |
null |
publication: |
PLoS One. 2014 Dec 11;9(12):e114691. doi: 10.1371/journal.pone.0114691. eCollection 2014. |
|