CAN_435 |
| origin: |
Constraining enzyme conformational change by an antibody leads to hyperbolic inhibition. |
| author: |
Oyen, D., Srinivasan, V., Steyaert, J., Barlow, J.N. |
| patent: |
no |
| patent_application_number: |
null |
| CDR1_seq: |
null |
| CDR1_length: |
|
| CDR2_seq: |
null |
| CDR2_length: |
|
| CDR3_seq: |
null |
| CDR3_lentgh: |
|
| protein_seq: |
QLQESGGGLVQPGGSLRLSCAASGFTFNNYWMYWVRRAPGKGLEWVSMINPGGIITKYAESVKGRFTISRDNAKNTLYLQ
MNSLTSEDTAVYYCAKDWATGLAKKGQGTQVTVSS |
| DNA_seq: |
null |
| PubMed_ID: |
21238460 |
| PDB_ID: |
3K74 |
| PDB_deposition_date: |
2009-10-12 |
| PDB_released_date: |
2010-10-20 |
| resolution: |
1.95Ã… |
| source_organism: |
Lama glama |
| experiment_method: |
null |
| antigen: |
the enzyme dihydrofolate reductase (DHFR) |
| antigen_chain: |
null |
| antigen_seq: |
null |
| function: |
a potent allosteric inhibitor of DHFR, giving rise to mixed hyperbolic inhibition kinetic |
| validationORprediction: |
Experimentally Validated |
| epitope: |
null |
| bacteria_family: |
null |
| publication: |
J Mol Biol. 2011 Mar 18;407(1):138-48. doi: 10.1016/j.jmb.2011.01.017. Epub 2011 Jan 14. |
